Adiponectin - Detailed product view

Price: N/A - Request  Buy
Article Nr PAT-80008-2
Description Adiponectin, 15-244 aa, Human, Recombinant, E.coli
Sizes 0.5mg
Format liquid
Source/Host E. coli
Species Reactivity human
MW 25.1 kDa (231 aa)
Accession No   NP_004788
Alias names   AdipoQ, ACDC, ACRP30, APM1, GBP28
Purity   >90% by SDS PAGE
Sequence   MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAE
GPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYH ITVYMKDVKVSLFKKDKAMLFTY DQYQENNVDQASGSVLL HLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Concentration   1 mg/ml
Substrate/Buffer   In phosphate-buffered saline(pH 7.4) containing 1 mM DTT
Storage   Can be stored at +4C short term (1-2 weeks). For long term storage, aliquot and store at -20C or -70C. Avoid repeated freezing and thawing cycles.
References   Maeda K., et al. (1996) Biochem Biophys Res Commun. 221:286-9.
Berg AH., et al. (2001) Nat Med; 7:947-53
Berg AH., et al. (2002) Trends Endocrinol Metab. 13: 84-89.
Yamauchi T et al., (2002) Nat Med. 8:1288-95
Contents/Specifications   Endotoxin Level: < 1.0 EU per 1 microgram of protein (determined by LAL method)
Notes   Human Adiponectin, also referred to as AdipoQ, Acrp30, apm-1 or GBP28, is a secreted protein expressed exclusively in differentiated adipocyte(adipokine). Adiponectin contains a modular structure comprising an N-terminal collagenous domain followed by a C-terminal globular domain. Adiponectin plays a role in various physiological processes such as energy homeostasis and obesity. Plasma levels of adiponectin are reduced in obese humans, and decreased levels are associated with insulin resistance and hyperinsulinemia.
Supplier   BioSite
Price: N/A - Request  Buy