|
Alias names |
|
Transforming growth factor (TGF) beta-induced protein, TGFBI, βig-h3, Beta ig-h3, TGF BI, BIG h3
|
|
Sequence |
|
MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF
APTNEAFRALPPRERSRLLGDAKELANILKYH
IGDEILV
SGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDI
MATNGVVHVITNVLQPPA
|
|
Substrate/Buffer |
|
Liquid. 20mM Tris pH8.0 Molecular Weight: 14.5 kDa (135 a.a, residues 502-636)
|
|
Storage |
|
Store at -20 °C. Avoid freeze/thaw cycles
|
|
References |
|
Billings PC, et al. (2002). J Biol Chem. 277. 28003–28009
Munier FL. et al. (2002). Invest Ophthalmol Vis Sci. 43.949–954.
Jung-Eun Kim, et al.(2000) J Biol Chem. 275. 30907–30915
|
|
Notes |
|
BIGH3, also known as TGFBI and βig-h3, is an extracellular matrix protein induced by transforming growth factor(TGF)-beta 1. BIGH3 protein is involved in cell growth, cell differentiation, wound healing and cell adhesion. In addition, some missense mutations of BIGH3 were identified in families affected with human autosomal dominant corneal dystrophies. BIGH3 gene encodes for a 683 amino-acid protein containing an RGD motif and four internal repeated domains which have highly conserved sequences founded in several species (Fasciclin domain). Recombinant human BIGH3 protein (fourth FAS domain) was expressed in E. coli and purified by using conventional chromatography techniques.
|