BIGH3 - Detailed product view

Price: N/A - Request  Buy
Article Nr PAT-80030-2
Description BIGH3 , Fasciclin domain 4 (502-636aa) Human, Recombinant, E.coli
Sizes 0.5mg
Source/Host E.coli
Species Reactivity human
MW 14, 5 kDa
Alias names   Transforming growth factor (TGF) beta-induced protein, TGFBI, βig-h3, Beta ig-h3, TGF BI, BIG h3
Purity   >95% by SDS PAGE
Sequence   MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF
APTNEAFRALPPRERSRLLGDAKELANILKYH
IGDEILV
SGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDI
MATNGVVHVITNVLQPPA
Concentration   1 mg/ml
Substrate/Buffer   Liquid. 20mM Tris pH8.0 Molecular Weight: 14.5 kDa (135 a.a, residues 502-636)
Storage   Store at -20 °C. Avoid freeze/thaw cycles
References   Billings PC, et al. (2002). J Biol Chem. 277. 28003–28009
Munier FL. et al. (2002). Invest Ophthalmol Vis Sci. 43.949–954.
Jung-Eun Kim, et al.(2000) J Biol Chem. 275. 30907–30915
Notes   BIGH3, also known as TGFBI and βig-h3, is an extracellular matrix protein induced by transforming growth factor(TGF)-beta 1. BIGH3 protein is involved in cell growth, cell differentiation, wound healing and cell adhesion. In addition, some missense mutations of BIGH3 were identified in families affected with human autosomal dominant corneal dystrophies. BIGH3 gene encodes for a 683 amino-acid protein containing an RGD motif and four internal repeated domains which have highly conserved sequences founded in several species (Fasciclin domain). Recombinant human BIGH3 protein (fourth FAS domain) was expressed in E. coli and purified by using conventional chromatography techniques.
Supplier   BioSite
Price: N/A - Request  Buy