|
Alias names |
|
AdipoQ, ACDC, ACRP30, APM1, GBP28
|
|
Sequence |
|
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAE
GPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYH ITVYMKDVKVSLFKKDKAMLFTY DQYQENNVDQASGSVLL HLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
|
|
Substrate/Buffer |
|
In phosphate-buffered saline(pH 7.4) containing 1 mM DTT
|
|
Storage |
|
Can be stored at +4C short term (1-2 weeks). For long term storage, aliquot and store at -20C or -70C. Avoid repeated freezing and thawing cycles.
|
|
References |
|
Maeda K., et al. (1996) Biochem Biophys Res Commun. 221:286-9.
Berg AH., et al. (2001) Nat Med; 7:947-53
Berg AH., et al. (2002) Trends Endocrinol Metab. 13: 84-89.
Yamauchi T et al., (2002) Nat Med. 8:1288-95
|
|
Contents/Specifications |
|
Endotoxin Level: < 1.0 EU per 1 microgram of protein (determined by LAL method)
|
|
Notes |
|
Human Adiponectin, also referred to as AdipoQ, Acrp30, apm-1 or GBP28, is a secreted protein expressed exclusively in differentiated adipocyte(adipokine). Adiponectin contains a modular structure comprising an N-terminal collagenous domain followed by a C-terminal globular domain. Adiponectin plays a role in various physiological processes such as energy homeostasis and obesity. Plasma levels of adiponectin are reduced in obese humans, and decreased levels are associated with insulin resistance and hyperinsulinemia.
|