Article No
ARP32799_T100-Biotin
ACDC
ACDC Antibody - N-terminal region : Biotin
Antibodies Primary
Specifications
| MW | 27kDa |
| Accession Number | NM_004797, NP_004788 |
| Application | IHC, WB |
| Article No | ARP32799_T100-Biotin |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | Biotin |
| Description | ACDC Antibody - N-terminal region : Biotin |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 9370 |
| Gene Symbol | ADIPOQ |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACDC |
| Notes | Adiponectin (ACDC) is expressed in adipose tissue exclusively. It is similar to collagens X and VIII and complement factor C1q. Adiponectin circulates in the plasma and is involved with metabolic and hormonal processes. |
| Previous Article No | ARP32799_T100-Biotin-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, goat, horse/equine, human, mouse, pig/porcine, rabbit, rat |
| Product Type | Antibodies Primary |
| Purification | Purified |
| Sequence | KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, goat, horse/equine, human, mouse, pig/porcine, rabbit, rat |
| Storage | 4°C, -80°C |
| UniProt Number | Q15848 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
