Article No
ARP42343_P050-Biotin
MW | 18 |
Accession Number | NM_007099, NP_009030 |
Application | IHC, WB |
Article No | ARP42343_P050-Biotin |
Availability | In Stock |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Conjugation | Biotin |
Description | ACP1 Antibody - middle region : Biotin |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 52 |
Gene Symbol | ACP1 |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACP1 |
Notes | ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. |
Previous Article No | ARP42343_P050-Biotin-100 |
Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, human, mouse, pig/porcine, rat |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA |
Shipping Information | BLUE ICE |
Size | 100ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, human, mouse, pig/porcine, rat |
Storage | 4°C, -80°C |
UniProt Number | P24666 |
Product Page Updated | 2024-03-06T13:52:09.583Z |