Article No
ARP52920_P050
MW | 22kDa |
Accession Number | NM_025582, NP_079858 |
Application | WB |
Article No | ARP52920_P050 |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Description | 2810405K02Rik antibody - middle region |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 66469 |
Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Gene Symbol | Prxl2b |
Notes | 2810405K02Rik catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. It also be able to reduce prostaglandin H2 to prostaglandin F(2alpha). |
Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rat |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | Synthetic peptide located within the following region: SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS |
Shipping Information | BLUE ICE |
Size | 100 ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rat |
Storage | -20°C, 4°C |
UniProt Number | Q9DB60 |
Product Page Updated | 2024-03-06T13:52:09.583Z |