Article No
ARP53392_P050
Specifications
| MW | 28kDa |
| Accession Number | NM_181533, NP_853511 |
| Application | WB |
| Article No | ARP53392_P050 |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Description | ABHD12B antibody - middle region |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 145447 |
| Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Gene Symbol | ABHD12B |
| Notes | The function of this protein remains unknown. |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | Synthetic peptide located within the following region: ARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVAS |
| Shipping Information | BLUE ICE |
| Size | 100 ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, fish |
| Storage | -20°C, 4°C |
| UniProt Number | Q7Z5M8 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
