Article No
ARP53424_P050-FITC
MW | 18kDa |
Accession Number | NM_025423, NP_079699 |
Application | WB |
Article No | ARP53424_P050-FITC |
Availability | In Stock |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Conjugation | FITC |
Description | 1110059E24Rik Antibody - N-terminal region : FITC |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 66206 |
Gene Symbol | 1110059E24Rik |
Notes | The function of this protein remains unknown. |
Previous Article No | ARP53424_P050-FITC-100 |
Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | TFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKC |
Shipping Information | BLUE ICE |
Size | 100ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat |
Storage | 4°C, -80°C |
UniProt Number | Q9CQ90 |
Product Page Updated | 2024-03-06T13:52:09.583Z |