Article No
ARP53424_P050-FITC
1110059E24Rik
1110059E24Rik Antibody - N-terminal region : FITC
Antibodies Primary
Specifications
| MW | 18kDa |
| Accession Number | NM_025423, NP_079699 |
| Application | WB |
| Article No | ARP53424_P050-FITC |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | FITC |
| Description | 1110059E24Rik Antibody - N-terminal region : FITC |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 66206 |
| Gene Symbol | 1110059E24Rik |
| Notes | The function of this protein remains unknown. |
| Previous Article No | ARP53424_P050-FITC-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | TFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKC |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat |
| Storage | 4°C, -80°C |
| UniProt Number | Q9CQ90 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
