Antibodies Primary

0910001L09Rik Antibody - N-terminal region

NEW
0910001L09Rik Antibody - N-terminal region

Article No

ARP54397_P050-100

Application

WB

Species Reactivity

cow/bovine
dog/canine
guinea pig
human
mouse
rabbit
rat
fish

Size

100 ul

Source / Host

rabbit

Shipping Information

BLUE ICE

Documentation

Suggested protocols

Specifications

MW 11kDa
Accession Number NM_001081108, NP_001074577
Additional Information The function of this protein remains unknown.
Application WB
Article No ARP54397_P050-100
Country Availability SE, FI, DK, NO, IS, EE, LV, LT, FO, GL, RU
Clone Type polyclonal
Description 0910001L09Rik Antibody - N-terminal region
Supplier Aviva Systems Biology
Entrez Gene ID 66096
Format Liquid
Gene Symbol Lamtor4
Keywords Polyclonal; Developmental Biology;
Notes The function of this protein remains unknown.
Alias Names AV006840, 0910001L09Rik
Product Type Antibodies Primary
Purification Affinity Purified
Sequence Synthetic peptide located within the following region: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA
Shipping Information BLUE ICE
Size 100 ul
Source / Host rabbit
Species Reactivity cow/bovine, dog/canine, guinea pig, human, mouse, rabbit, rat, fish
Storage 4°C
Substrate / Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Technical Specifications The function of this protein remains unknown.
UniProt Number Q8CF66
Product Page Updated 2021-09-09T09:55:48.834Z

Shipping info

The delivery time for this item is approximately 8-16 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.