Article No
ARP55633_P050-Biotin
MW | 49kDa |
Accession Number | NM_001033145, NP_001028317 |
Application | WB |
Article No | ARP55633_P050-Biotin |
Availability | In Stock |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Conjugation | Biotin |
Description | Dipk2a Antibody - N-terminal region : Biotin |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 68861 |
Gene Symbol | Dipk2a |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 1190002N15Rik |
Notes | The function of this protein remains unknown. |
Previous Article No | ARP55633_P050-Biotin-100 |
Predicted Species Reactivity | cow/bovine, dog/canine, human, mouse, rabbit, rat |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR |
Shipping Information | BLUE ICE |
Size | 100ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, human, mouse, rabbit, rat |
Storage | 4°C, -80°C |
UniProt Number | Q3USZ8 |
Product Page Updated | 2024-03-06T13:52:09.583Z |