Article No
ARP55633_P050-FITC
Dipk2a
Dipk2a Antibody - N-terminal region : FITC
Antibodies Primary
Specifications
| MW | 49kDa |
| Accession Number | NM_001033145, NP_001028317 |
| Application | WB |
| Article No | ARP55633_P050-FITC |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | FITC |
| Description | Dipk2a Antibody - N-terminal region : FITC |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 68861 |
| Gene Symbol | Dipk2a |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 1190002N15Rik |
| Notes | The function of this protein remains unknown. |
| Previous Article No | ARP55633_P050-FITC-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, human, mouse, rabbit, rat |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, human, mouse, rabbit, rat |
| Storage | 4°C, -80°C |
| UniProt Number | Q3USZ8 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
