Article No
BPS-52036
Histone H2a, Full Length, Biotin-labeled, His-tag Recombinant
Histone H2a, Full Length, Biotin-labeled, His-tag Recombinant
Proteins & Peptides
Specifications
| MW | 15 kDa |
| Accession Number | NM_033445 |
| Additional Information | Biotinylated Human Histone 2A, GenBank Accession No. NM_033445, a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa, expressed in an E. coli expression system. |
| Article No | BPS-52036 |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT |
| Conjugation | Biotin |
| Description | Histone H2a, Full Length, Biotin-labeled, His-tag Recombinant |
| Supplier | BPS Bioscience |
| Entrez Gene ID | 92815 |
| Format | Aqueous buffer solution |
| Gene Symbol | HIST3H2A |
| Notes | Biotinylated Human Histone 2A, GenBank Accession No. NM_033445, a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa, expressed in an E. coli expression system. |
| Alias Names | HIST1H2AI, H2A.1, histone H2A |
| Product Type | Proteins & Peptides |
| Sequence | MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC |
| Shipping Information | -80°C (dry ice) |
| Size | 0.5 mg |
| Species Reactivity | human |
| Storage | At least 6 months at -80°C. |
| Substrate / Buffer | 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 3 mM DTT, and 20% glycerol |
| Technical Specifications | Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications. |
| UniProt Number | Q7L7L0 |
| Product Page Updated | 2024-01-09T13:23:45.900Z |
