This item can unfortunately not be purchased via our website. Please send an email to info@nordicbiosite.com, and we will handle your order directly.
Protein on Demand (RS)-norcoclaurine 6-O-methyltransferase Recombinant Protein (Japanese goldthread)
Protein on Demand (RS)-norcoclaurine 6-O-methyltransferase Recombinant Protein (Japanese goldthread)
Proteins & Peptides
On Request
Specifications
Additional Information | Listed price is for proteins expressed in E.Coli. If you would like a quote for a different expression system (ie. Yeast, Mammalian, Baculovirus), please contact support@nordicbiosite.com |
Application | ELISA, WB |
Article No | OPCA327036-20 |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Description | Protein on Demand (RS)-norcoclaurine 6-O-methyltransferase Recombinant Protein (Japanese goldthread) |
Supplier | Aviva Systems Biology |
Format | Lyophilized powder |
Product Type | Proteins & Peptides |
Purity | >85% |
Sequence | MEVKKDNLSSQAKLWNFIYGFAESLVLKCAVQLDLANIIHNSGTSMTLSELSSRLPSQPVNEDALYRVMRYLVHMKLFTKASIDGELRYGLAPPAKYLVKGWDKCMVGSILAITDKDFMAPWHYLKDGLSGESGTAFEKALGTNIWGYMAEHPEKNQLFNEAMANDSRLIMSALVKECGNIFNGITTLVDVGGGTGTAVRNIANAFPHIKCTVYDLPHVIADSPGYSEVHCVAGDMFKFIPKADAIMMKCILHDWDDKECIEILKRCKEAVPVKGGKVIIVDIVLNVQSEHPYTKMRLTLDLDMMLNTGGKERTEEEWKKLIHDAGYKGHKITQITAVQSVIEAYPY |
Size | 20ug |
Storage | 4°C, -80°C |
UniProt Number | Q9LEL6 |
Product Page Updated | 2024-03-07T13:09:17.120Z |