This item can unfortunately not be purchased via our website. Please send an email to info@nordicbiosite.com, and we will handle your order directly.
Protein on Demand 0610009B22RIK Recombinant Protein (Mouse)
Protein on Demand 0610009B22RIK Recombinant Protein (Mouse)
Proteins & Peptides
On Request
Specifications
| Additional Information | Listed price is for proteins expressed in E.Coli. If you would like a quote for a different expression system (ie. Yeast, Mammalian, Baculovirus), please contact support@nordicbiosite.com |
| Application | ELISA, WB |
| Article No | OPCA332125-20 |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Description | Protein on Demand 0610009B22RIK Recombinant Protein (Mouse) |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 66050,66226 |
| Format | Lyophilized powder |
| Gene Symbol | 0610009B22Rik, Trappc2 |
| Predicted Species Reactivity | mouse |
| Product Type | Proteins & Peptides |
| Purity | >85% |
| Sequence | MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS |
| Size | 20ug |
| Storage | 4°C, -80°C |
| UniProt Number | Q9CQP2 |
| Product Page Updated | 2024-03-07T13:09:17.120Z |
